General Information

  • ID:  hor004682
  • Uniprot ID:  Q9M2Y0
  • Protein name:  Phytosulfokine-beta
  • Gene name:  PSK3
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Phytosulfokine family
  • Source:  Plant
  • Expression:  Up-regulated by wounding. |Expressed in roots, mature leaves, stems, flowers and siliques. Most abundant in vascular bundles.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0030154 cell differentiation; GO:0071456 cellular response to hypoxia
  • GO CC:  GO:0005576 extracellular region; GO:0005794 Golgi apparatus; GO:0031012 extracellular matrix

Sequence Information

  • Sequence:  YIYT
  • Length:  4
  • Propeptide:  MGKFTTIFIMALLLCSTLTYAARLTPTTTTALSRENSVKEIEGDKVEEESCNGIGEEECLIRRSLVLHTDYIYTQNHKP
  • Signal peptide:  MGKFTTIFIMALLLCSTLTYA
  • Modification:  T1 Sulfotyrosine;T3 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9M2Y0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004682_AF2.pdbhor004682_ESM.pdb

Physical Information

Mass: 61232 Formula: C28H38N4O8
Absent amino acids: ACDEFGHKLMNPQRSVW Common amino acids: Y
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: 30 Boman Index: 207
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: -1372.5 Extinction Coefficient cystines: 2980
Absorbance 280nm: 993.33

Literature

  • PubMed ID:  11706167
  • Title:  Diversity of Arabidopsis Genes Encoding Precursors for Phytosulfokine, a Peptide Growth Factor